Welcome to Kuwait Yellow Pages Online
Kuwait Yellow Pages Online KUWAIT YELLOW PAGES ONLINE
Global Site for local Search
Get it on Google Play
Elite Products in Industrial Supplies Market of Kuwait

Carpentry Works (Wardrobe, File Racks, Work Station, Table, cabinets)

We provide handyman services and make a best quality ofWardrobeFile RacksWork StationTablesCabinetscupboards
Supplier : Muhammad Shahid Raza Technical Services L.L.C DUBAI
Posted On :2 weeks ago

Heavy Eqpt Spare Parts

ITR's extensive range of replacement products includes over 100,000 products available for use on Crawlers, Excavators and Wheeled equipment manufactured by Cat, CNH, Deere, Hitachi, and Komatsu along with many other quality equipment manufacturers.
Supplier : Al Asfar Spare Parts Trading LLC SHARJAH
Posted On :2 weeks ago

ELECTRIC BLOWERS IN DUBAI

Everest brand Electric blowers in 220V from 8" to 20" DiaFor inquiries contact : sales@murtuzatrading.com or call : 050-6325514 
Supplier : MURTUZA TRADING SHARJAH
Posted On :2 weeks ago

3M ELECTRICAL TAPES

3M ELECTRICAL TAPES
Supplier : AVENSIA GENERAL TRADING LLC DUBAI
Posted On :2 weeks ago

Coupling nut

Product Description:We are recognized as a prominent manufacturer, supplier and exporter of qualitative arrays of Coupling Nuts.These products are sturdily constructed with perfection in a well-equipped infrastructure unit.The entire range of these products is manufactured in strict compliance with the set standards and norms of the industry.Our offered array of these products is widely appreciated for the following features:SturdinessDurability Accuracy
Supplier : PRAGATI METAL CORPORATION MUMBAI
Posted On :3 weeks ago

SHAFT SLEEVES

p { margin-bottom: 0.25cm; direction: ltr; color: rgb(0, 0, 10); line-height: 120%; text-align: left; }p.western { font-family: "Calibri",serif; font-size: 11pt; }p.cjk { font-family: "Calibri"; font-size: 11pt; }p.ctl { font-size: 11pt; } Material : Available In Stainless Steel Gr. 304 & Gr. 316 We offer upper shaft sleeves & intermediate shaft sleeves for 4” submersible pumps. we also offer sleeves as customers specification. These sleeves are manufactured with the best grade material & sophisticated technology to deliver flawless. Quality material.
Supplier : HITANSHI METAL MUMBAI
Posted On :3 weeks ago

Steel Fabrication

Supplier : Seven Grace General Trading FZE AJMAN
Posted On :3 weeks ago

FUCHS LUBRITECH GLEITMO HMP 9020 K / GHANIM TRADING DUBAI UAE, OMAN +971 4 2821100

GLEITMO HMP 9020 K GLEITMO HMP 9020 K is suitable for the lubrication of bulk parts like stud-bolts, nuts, sheet metal screws and tension springs. For hot galvanized high-tensile fasteners, the standard for lubricant requirements DIN EN 14399 is fulfilled by using of GLEITMO HMP 9020 K. GLEITMO HMP 9020 K is an advance development of GLEITMO HMP 9020 with enhanced corrosion protection properties.
Supplier : GHANIM TRADING LLC DUBAI
Posted On :3 months ago

Rubbish Chute

Construction Garbage ChuteIdeal for the safe disposal of rubble from high levels, this chute is quickly and easily
Supplier : Reunion Safety Equipment Trading ABU DHABI
Posted On :4 months ago

Bucket Elevator Chains In Oman

We are a leading manufacturer and exporter of Bucket Elevator Chains.
Supplier : B. V. Transmission Industries MUMBAI
Posted On :4 months ago

Elcometer Coating Thickness Gauge

To measure paint thickness on Steel, Aluminium, Concrete etc.
Supplier : Elcometer UAE ABU DHABI
Posted On :5 months ago

PIN FACE WRENCH

Supplier : Gulf Safety Electromechanical (info@gulfsafetyuae.com) ABU DHABI
Posted On :5 months ago

Acrylic Hand Rail supplier in Dubai

  For More Details :- Krunal Patel M           + 971509222146 E           krunal@sabinplastic.com
Supplier : Sabin Plastic Industries LLC SHARJAH
Posted On :6 months ago

BUTYL ANTI-CORROSION TAPE, BUTYL UV PROTECTION TAPE

Butyl Corrosion Tape used as an anti-corrosive coating, waterproofing, moisture/vapour sealing system in the pipelines, building and construction industriesButyl Sealant Tapes
Supplier : AL SAD Importing & Trading Est. (AL SAD) ABU DHABI
Posted On :6 months ago

TOLSEN HEAVY DUTY TILE CUTTER

TOLSEN HEAVY DUTY TILE CUTTER REPLACABLE CUTTING BLADES:15X6X1.5MMMAX CUTTING:12MM
Supplier : AL TOWAR OASIS TRADING DUBAI
Posted On :6 months ago

TARPAULIN SUPPLIER in RASHIDIYA

GOLDEN LIGHTS TRADING LLC POST BOX # 27529, DUBAI, UAE Tel: +971 4 2257673 Fax: +971 4 2257981 Email: sheerazi@eim.ae Email: info@goldenlightuae.com URL: www.goldenlightuae.com
Supplier : GOLDEN LIGHTS TRADING LLC DUBAI
Posted On :6 months ago

Dixell Controllers

Supplier : ABU SAEED TRADING LLC DUBAI
Posted On :7 months ago

ARO Diaphragm Pumps by Ingersoll Rand

Sizes available:  1/4", 3/8", 1/2", 3/4", 1", 1 1/2", 2" and 3".MOC Available: Non-Metallic: Polypropylene, Groundable Polypropylene or Acetal, PVDFMetallic: Cast Iron, Aluminium, Stainless Steel, HastelloyElastomers & Diaphragms: Neoprene, Nitrile (Buna-N), Santoprene, Hytrel, Urethane, EPDM, PTFE, Viton.A favorite among process professionals, ARO diaphragm pumps are a truly versatile solution for numerous applications. Known for its industry-leading efficiency and reliability, flow rates of up to 275 GPM (1041 LPM) and a large range of material and porting configurations, ARO has the right pump for your application. With proven performance in the field and backed by a 5-year warranty, ARO EXP diaphragm pumps deliver consistency and reliability in the most demanding situations.These do-all pumps are suitable and known for applications like;Chemical pumpsAcid pumpsSolvent PumpsInk PumpsPackaging PumpsDewatering PumpsDosing PumpsBatching PumpsMarine PumpsSeal-less PumpsPowder PumpsSubmersible PumpsCleaning PumpsTank-cleaning pumpsDrum PumpsBarrel PumpsHigh Pressure PumpsCeramic PumpsOil PumpsFuel PumpsPaint PumpsTransfer PumpsBlending PumpsRe-circulation PumpsGlue PumpsStarch PumpsRotogravure Machine PumpsPrinting PumpsUV Ink PumpsHydrocarbon PumpsDiesel Oil PumpsThermal Oil PumpGlaze Pump
Supplier : ARO Pumps by Ingersoll Rand DUBAI
Posted On :7 months ago

"L" BOLT

With the help of our skilled workforce and manufacturing unit, we are engrossed in offering a huge range of L Bolt. The offered bolt is fabricated from top quality material and latest techniques at our well equipped manufacturing unit. In addition to this, entire range of offered bolts undergoes series of tests under the strict vigilance of our quality experts. 
Supplier : kalpataru piping solutions MUMBAI
Posted On :7 months ago

Industrial Washing machines

mplements and modernizes complete systems. We focus on resource conserving consumption and environmentally compatible water treatment: integrated recovery systems ensure that you save energy, water and chemicals. First time in India, we have designed, manufactured and have commissioned of modular wet treatment systems. It stands for perfect corrosion protection of Metal parts, body and for its quality and value retention.Throughout the ent i re c leaning, pretreatment and ED process we make sure that all components interact perfectly. With standardized components and parts - designed, integrated and implemented by smooth interfaces and process sequences are assured
Supplier : RAJ SYSTEM PVT LTD PUNE
Posted On :7 months ago

Machine Nuts

Price:•All Forged Fittings From 20/- To 10000/- Per No Designed for a broad set of application, we offer you a range of Machine Nuts(Lateral Tee ). Our comprehensive line of standard precision-engineered nuts is superior to cold formed and punched nuts. These ready to use machine nuts are reliable in nature and also have a long serving life. Lauded for our quality range, we assure the satisfaction of our customers.Features:Corrosion resistanceLightweightGood quality
Supplier : SHUBHAM ENTERPRISE MUMBAI
Posted On :7 months ago

GENERATORS HIRE

Diesel Power Plant Hire from 1 MW to 100 MW Temporary Power from 1 MW to 100 MW Solar Hybrid Rental Power plantsSupply of Diesel Generator on Hire including: 50 kVA Diesel Generator80 kVA Diesel Generator100 KVA Diesel Generator125 kVA Diesel Generator250 kVA Diesel Generator300 kVA Diesel Generator360 kVA Diesel Generator500 KVA Diesel Generator800 kVA Diesel Generator1000 KVA Diesel Generator1250 KVA Diesel GeneratorGas generators Hire
Supplier : SES Smart Energy Solutions Fzco DUBAI
Posted On :8 months ago

WATER PUMP BEARING

Supplier : Super Perkins Facilities Management & Services L DUBAI
Posted On :9 months ago

Roots Multiclean Uae

AL NOJOOM AL KHAMS BUILDING CLEANING MAT TRD LLC. IS THE ONE OF LEADING CLEANING EQUIPMENT TRADING COMPANY IN UAE SINCE 2010.  ROOTS IS OUR EXCUSLIVE BRAND IN UAE, AND WE ARE THE ONE AUTHORISED DISITRIBUTOR OF ROOTS IN UAE REGION
Supplier : AL NOJOOM CLEANING EQUIPMENT LLC AJMAN
Posted On :9 months ago

Butt Weld Fittings

We are offering wide range of butt weld fittings like:-Stainless Steel Butt Weld Fittings-Hastelloy Butt Weld Fittings-Alloy-20 Butt Weld Fittings-Duplex Butt Weld Fittings-Alloy Steel Butt Weld Fittings.*Features:-Made of high grade raw material-Easy fitting-Long lasting-Corrosion resistance-Dimensionally accurate-Reasonable price.*Delivery: As per the client's schedule.*Customization: Deliver customized products.*Packaging: Durable and safe packaging.*Clients: Spread all across the nation.
Supplier : METAL TRADING CORPORATION MUMBAI
Posted On :10 months ago

Pipe Wrench

Prayas Metal India Pvt. Ltd. has garnered immense reputation as a Stockist & Exporter of Pipe Wrench. These Pipe Wrenches are used for turning soft iron pipes and fittings with a rounded surface. In general words, these Pipe Wrenches are used to tighten and loose pipe joints. We offer these Pipe Wrenches at very affordable prices.
Supplier : PRAYAS METAL (INDIA) PVT.LTD. MUMBAI
Posted On :10 months ago

Butt Weld Fittings

We are the stalwarts in the domain of manufacturing, supplying, distributing, importing and exporting a wide gamut of SS 904l Butt Weld Fittings. Manufactured using finest quality stainless steel, our range is applauded for its easy fitting, dimensional accuracy, corrosion resistance and fine finishing. Moreover, we offer these fittings in various specifications at nominal prices.Size: 1/8"NB to 48"NB inSchedule: SCH20, SCH30, SCH40, STD, SCH80, XS, SCH60, SCH80, SCH120, SCH140, SCH160, XXSType: Seamless / ERW / Welded / FabricatedMaterials:Stainless Steel 904L Buttweld Fittings – SS 904L Buttweld FittingsASTM A403 WP Gr. 904L
Supplier : Renine Metalloys MUMBAI
Posted On :11 months ago

Labelling Machine

Labelling Machine in UAE
Supplier : Total Packaging Solutions FZC SHARJAH
Posted On :11 months ago

POWER TOOL SUPPLIERS UAE (BLACK AND DECKER/DEWALT)

CordlessDrills & Fastening toolsHammers & Diamond cutting toolsDust ManagementGrinders & Metalworking toolsWoodworking toolsSpecialty ToolsSaws
Supplier : Sadeem Building Material Trading Co DUBAI
Posted On :11 months ago

UNIOR TOOLS SUPPLIER

Unior hand tools is the world’s leading supplier of insulated hand tools and automotive tools providing superior quality hand tools. Unior hand tools includes wrenches, sockets, plier, Insulated tools, plumbing tools,shears,screwdrivers,pullers,hammers,punches,chisels,workshop equipment, measuring tools, tools for electronic equipment, automotive tools, vices, clamps, saws, files, wheels, levers, utility knife, tool sets. Unior is a European tools manufacturer with headquarters in Slovenia. Adex International is the premier supplier of Unior hand tools in the UAE with operations in all emirates like Dubai, Abu Dhabi , Sharjah, Ajman, Alain, Umm Al Quwain, Ras Al Khaimah. All the hand tools are manufactured with the best quality raw materials so as to adhere to strict safety standards  Open end wrenchCombination wrenchRing wrenchRatchet wrenchSlogging wrenchHook wrenchSocket wrenchTubular wrenchInbus wrenchChain wrenchSocket setImpact socketCombination plierDiagonal cutterEnd cutterFlat nose plierRound nose plierWater pump and double groove joint plierCrimping plierRing terminalLock ring plierCarpenter and tower pincerGrip plierTile pincerPunch plierInsulated open end wrenchInsulated ring wrenchInsulated socket wrenchInsulated inbus wrenchInsulated socketInsulated torque wrenchInsulated combination plierInsulated water pump plierInsulated diagonal and end cutterInsulated flat and round plierInsulated stripperInsulated cable shearInsulated flat screwdriverInsulated crosstip screwdriverInsulated inbus screwdriverInsulated screwdriver with TX profileInsulated socket screwdriverInsulated voltage testerInsulated cutterInsulated sawInsulated tweezersInsulated tools setWater pump plierPipe wrenchBending toolsCutting toolsTest pumpChain wrenchYoke viceThreestandTin snipLever tin snipNibblerSteel wire cutterPvc pipe cutterCable shearWire rope plier plierThreaded rod cutterBolt cutterPruning shearsScrewdriverMagnetizerRatchet handleBladesBits2 leg puller3 leg puller5 leg pullers and extractorsSeparatorsHomo kinetic pullers for carsLock smiths hammerSledgehammerClub hammerBumping hammerPunchesChiselsWork benchesTools chestToolboxTools cabinetsMetal standsPlastic tool boxTools trolleyToolbagTorque wrenchDigital vernierTorque multiplierMeasuring tapeSpirit levelMason profilesScriberFlat ruleplumb bobplierscrewdrivercar maintenance toolgrip hose clampcollar plierslotholder plierquick couplerplier for fuel pipespick up toolspring clip pliermagnetic trayauto inspection kitclaw pick up tooloil filter wrenchadjustable oil filter wrenchstrap wrenchbody repair kitWindscreen suction lifterHub and wheel drum pullerWheel balancing plierWire brushHandbrake wire plierWheel nut wrenchCar light testertiming pullery pullerbicycle repair toolsbike toolsvicesclampssawsfilesraspsscraperscrew extractorcutting wheelgrinding wheellevergaugesriverteraxetweezersoil cangrease gun     UNIOR TOOLS UNIOR TOOLS  UAEUNIOR TOOLS SUPPLIERUNIOR UAEUNIOR OMANUNIOR SAUDI ARABIAUNIOR BAHRAINUNIOR QATAR UNIOR DUBAIUNIOR SHARJAHUNIOR ABUDHABIUNIOR WHOLESALERUNIOR MAIN DEALERWHERE TO BUY UNIOR TOOLS IN UAE  
Supplier : ADEX INTL/ 0558763747/ phiju@adexuae.com /sales@adexuae.com DUBAI
Posted On :11 months ago

Nut

EXCEL METAL & ENGG INDUSTRIES Fittings are designed for Instrumentation and Process Control System Tubing, Double Ferrule Compression Tube Fittings are provided for leak proof, torque free seal at all tubing connections, and eliminates costly hazardous leaks in process and instrumentation tubing lines, EXCEL METAL & ENGG INDUSTRIES . also manufacture Single Compression Type Fittings.EXCEL METAL & ENGG INDUSTRIES . offers Single Ferrule, Double Ferrule type Male / Female Connectors, Unions, Bulk Head Unions, Cross, Elbow, Tee, Tube Plug and Tube Cap in various sizes.M.O.C: SS304, SS316, Carbon Steel , Brass , nickel alloy , etcSizes: As per customer’s RequirementEnd Connections: NPT / BSP / BSPT / UNFRating: 1500, 3000, 6000, 10000 PSI.
Supplier : EXCEL METAL & ENGG. INDUSTRIES MUMBAI
Posted On :11 months ago

Hoses SHARJAH

Hoses SHARJAH
Supplier : Bright Future Int. Sanitaryware Trading SHARJAH
Posted On :11 months ago

MILLING CNC SERVICES IN UAE

www.bppcouae.com  AL BARSHA PRECISION MOLDING DIES IND. L.L.C  For industries related to Oil & Gas field, Fabrication etc. we can do the CNC job work  as per customer’s requirement. As a Mould Making Company we can also design and manufacture Injection Mould according to your requirement.
Supplier : AL BARSHAA PLASTIC PRODUCT COMPANY LLC SHARJAH
Posted On :12 months ago

Hydraulic Diaphragm Pump

Our company is one of the preferred choices of our customers for proffering oil-free Hydraulic Diaphragm Pump. Manufactured as per the set industry norms, these efficient pumps are widely used in applications, where a dry and oil-free vacuum is required. These pumps are known for their excellent speed.  Features: Longer service life Portable Less energy consumed Specifications: Compact diaphragm pump with a pumping speed: Upto 0.7 m3/hFor mains voltage: 90-127 V, 50 Hz, respectively 187-265 V, 60 HzIdeal for applications where a dry and oil-free vacuum is required2 = 2-stage diaphragm pump for easy applications 4 = 4-stage diaphragm pump for best ultimate pressureAdditional Information:Item Code: MVP0152
Supplier : Pfeiffer Vacuum AJMAN
Posted On :12 months ago

TAPE SUPPLIERS IN UAE

Our wide range of tapes are available to cater for any requirement you may have. Each tape is specifically designed to perform in a specific environment. 
Supplier : Development Generation General Trading DUBAI
Posted On :12 months ago

Aluminum job-ALUMINUM CABIN

Aluminum cabin -Aluminum profile ,Aluminum HPL sheet ,Tempered glass  and Silicone Making Cabin with Half glass, Half HPL sheetSingle Door , Double Door Roof with Sheet and Frame 
Supplier : Euro Steel and Aluminium LLC &Euro rubbertech intl LLC Umm Al Quwain
Posted On :12 months ago

steel gates by Maxwell Automatic Doors Co LLC Post box 82715 Dubai – UAE Tel: +971 4 2976951 Mobile: +971 50 4405076 Email: Estimation@maxwelldoors.com www.maxwelldoors.com

steel gates in uaesteel gate suppliers in uaesteel gate manufacturerssteel gate workssteel fabricators in uae Maxwell Automatic Doors Co LLC Post box 82715 Dubai – UAE Tel: +971 4 2976951 Mobile: +971 50 4405076 Email: Estimation@maxwelldoors.com www.maxwelldoors.com
Supplier : Maxwell Automatic Doors Co LLC DUBAI
Posted On :12 months ago

GARNET SUPPLIER IN DUBAI

Garnet Size 30 -60 mesh20-40 mesh.for sand blasting, etc..FOR MORE DETAILS PLEASE CONTACT;EMAIL : sales@plastochemfzc.comMobile: 0529934411
Supplier : Plastochem FZE AJMAN
Posted On :12 months ago

Bolts

Stainless Steel Bolts, Alloy Steel Stud Bolts, Monel Eye Bolts, Carbon Steel Hex Head Bolts Suppliers in India. Nickel Alloy J Bolts, Duplex Steel U Bolts Exporter, Inconel Foundation Bolts, SS Structural Bolts Leading Manufacturers. A.B. Stainless Steel is one of the largest exporter, manufacturer and supplier of Bolts in India. Many bolt heads as a supernumerary deadbolt the bolt in place, so that it does not change and an apparatus is just necessary for the nut end. Bolts are as well used as a widespread range of head designs, as do screws. In the meantime, these are being considered to join in by means of the tools that are being used to tighten them. A bolt is a construction of threaded fastener in the company of having an external male thread.These Bolts are consequently very much connected to, and frequently confused by means of, screws. Our Bolts Fastener can be accessible in custom-built length shapes and sizes, and are obtainable at market leading rates. For to meet up the piping requirements of our customers, these fasteners can as well be machined and fabricated. Bolts, Stud Bolts, Hex Head Bolts, U Bolts, J Bolts Specification Specifications : DIN, ASTM, BS and all International Standards Size : M3 - M56 3/6" to 2" Custom Sizes Length : 3 mm to 200 mm Type : Bolts, U- Bolts, J Bolts, Mushroom Head Square Neck Bolts, T-Head Bolts, Eye Bolt, Stud Bolts, Hex Head Bolts, Socket Hexagon Head Screw Anchor Bolt, Foundation Bolts, Structural Bolts. Our Bolts conforms to NACE MR0175/ISO 15156 Bolts Material & Grades Stainless Steel Bolts : AISI 302, 304, 304L,316, 316L, 310, 317, 317L, 321, 347, 410, 420,904L etc. Alloy Steel Bolts : ASTM / ASME A/SA 193 / 194 B 6, B 7/ B 7M, B 16, 2, 2HM, 2H, GR 6, B 7, B 7M Carbon Steel Bolts : ASTM A307, A193 Duplex & Super Duplex Steel Bolts : ASTM / ASME A815 UNS No. S31803, UNS No. S 32205, UNS No. S 31254, UNS No. S 31550, UNS No. S 32750, and UNS No. S 32760 Nickel Alloy Bolts : ASTM / ASME SB 160 / 164 / 425 / 166 / 446 / 574 / 472 UNS 2200 (NICKEL 200) / UNS 2201 (NICKEL 201), UNS 4400 (MONEL 400), UNS 8825 (INCONEL 825), UNS 6600 (INCONEL 600) / UNS 6601 (INCONEL 601), UNS 6625 (INCONEL 625), UNS 10276 (HASTELLOY C 276), UNS 8020 (ALLOY 20 / 20 CB 3) 
Supplier : A B Stainless Steel MUMBAI
Posted On :12 months ago

Inconel 600 Pipe Fittings`

Inconel 600 is a popular alloy used to manufacture Inconel 600 Pipe Fitting. Om tubes is a world renowned manufacturer and exporter of Inconel 600 pipe fitting to buyers worldwide. We offer specific materials like Inconel 600 Pipe Fitting in standardized products like pipe and tube fittings in varying sizes and finishes. Our sales service is the most prodigious and well known in the steel and pipes industry. We specialize in specific requirements of industries in special metals and alloys and deliver it promptly. Om tubes is a large stockiest of Inconel products and owns a mega storage unit of Inconel 600 Pipe Fittings, to meet any urgent requests for same day shipping. Om tubes aim to achieve a 100% customer satisfaction rate. To do so, we lay importance on every stage of purchase, from product enquiry to shipping. Om tubes have an export market in North America, Africa, Eastern Europe, UAE and Middle East countries.
Supplier : Om Tubes & Fitting Industries MUMBAI
Posted On :12 months ago

SPARE PARTS OF TOWER CRANE SUPPLIERS IN DUBAI

SPARE PARTS OF TOWER CRANE SUPPLIERS IN DUBAI
Supplier : AL QABDHA AL THAHABIA LIFTING AND LOADING EQUIPMENT MACHINERY TRADING DUBAI
Posted On :12 months ago

Pipe Warping Tapes

Pipe wrapping tape is made from spvc as the backing material, which are coated with rubber based adhesive. Good resistant to moisture, humidity, corrosion and temperature variations. Widely used in industr to protection of the air pipe, water pipe, oil pipe and steam pipe on the ground or underground from corrosion and abrasion. Supplying embossed film for easy tear and shiny film. Available in variety of widths, lengths and colors to meet your special requirement.Features:Exellent flexibility;Strong tensile strength;Anti-abrasion and anti corrosion;Good resistance to oil, chemical ad moisture;Non-deteriorating;
Supplier : WHITE CITY TRADING L.L.C DUBAI
Posted On :12 months ago

Metal detectable cable ties

EXPRESS COURIER DELIVERY TO ALL GCC COUNTRIES24X7 Customer SupportORDER NOW 00971 56 93 59 589 / info@novagreen.aewww.novagreen.ae
Supplier : Nova Green General Trading LLC AJMAN
Posted On :2 years ago

Draper Tools

Supplier : Western Corporation Limited FZE SHARJAH
Posted On :2 years ago

Chemical Storage Tank

We are the leading mfg off chemical storage tank from 100ltrs capacity upto 3 lac ltrs capacity in various grades of material ie: ss316/ss304/ ms /cs
Supplier : Ashtavinayaka Overseas MUMBAI
Posted On :2 years ago

Butt Weld Fittings

Creating a niche of Butt Weld Fittings such as Stainless Steel Butt Weld Fittings, Alloy Steel Butt Weld Fittings, Carbon Steel Butt Weld Fittings and Stainless Steel Pipe Fittings at its best, with utmost quality. Stainless Steel Butt Weld FittingsAlloy Steel Butt Weld FittingsButt Weld FittingsCarbon Steel Butt Weld FittingsStainless Steel Pipe Fittings
Supplier : PARASMANI ENGINEERS INDIA MUMBAI
Posted On :2 years ago

Chillers in sharjah

Chillers in sharjah
Supplier : Emirates Jo Trading Co. LLC SHARJAH
Posted On :2 years ago

INSULATION FOAM PROPERTIES IN SHARJAH

INSULATION FOAM PROPERTIES IN SHARJAH
Supplier : Isotherm Insulations Fze SHARJAH
Posted On :2 years ago

Stainless Steel Nut

Over the years, we have been busy in offering an elite compilation of Stainless Steel Nut that is used in machines. Our offered Stainless Steel Nut has gain wide approval in the souk owing to its qualitative features like durability and cost effectiveness. Furthermore, it is artificial using best quality basic material and higher machines in devotion to the set manufacturing norms. Our important client can avail this Stainless Steel Nut at most competitive price. Grade and Material Used:Grade SS : 304, 304 L, 316, 316 L, 317 L and 904 L Grade High Tensile : 8.8, 10.9, 12.9, 4.6, B 16Material : Titanium, Monal, Inconal, Hastelloy, Copper and AluminumFor Stainless Steel Nut feel free to contact us.
Supplier : Pearl Overseas MUMBAI
Posted On :2 years ago

LUBRICATION EQUIPMENT SUPPLIERS IN UAE

PRONTO - LUBRICATION OIL
Supplier : ABBAR GROUP (FZC) SHARJAH
Posted On :2 years ago

fabrication works

we so all type of steel fabrication works from stair case to mezzanines,plz call 00971555680048
Supplier : Doors & Shade Systems AJMAN
Posted On :2 years ago

Mikasa Tamping Rammer MT-72FW

Mikasa MT-72FW Tamping Rammer is Robin engine gasoline driven, the most efficient, lowest maintenance and productive ideal for the use in confined areas, compacting trenches, backfills and repairing work on asphalt. It is most suitable for compacting cohesive & non-cohesive soil. For more information visit www.almahroos.com 
Supplier : Al Mahroos Trading Est DUBAI
Posted On :2 years ago

STORAGE TANK FABRICATION IN UAE

STORAGE TANK FABRICATION IN UAE
Supplier : Muraibit Ship Spare Parts Trading LLC SHARJAH
Posted On :2 years ago

Industrial Cleaning Machines

Walk Behind Scrubber Dryer: Battery Operated HYPER 2250 BT / 50BTSuitable to work for the maintenance and deep cleaning of large areas (up to 2,200 m²).  User friendly control panel: forward speed setting, scrubbing and vacuuming selectors, battery charge indicator, traction direction indicator, key main switch.  Large handle with traction driving lever for forward and backward directions.  Self levelling brush plate. 
Supplier : CLEANTECH GULF FZCO DUBAI
Posted On :2 years ago

RUBBER GASKET SUPPLIERS IN SHARJAH

RUBBER GASKET SUPPLIERS IN SHARJAH
Supplier : ISMAT RUBBER PRODUCTS IND SHARJAH
Posted On :2 years ago

JCB for rent -052-418-8285

Our Heavy Equipment Trading Establishment is a well established professional company known for our reliable service in the U.A.E market for the last 5 years and we have3,5, tons forklifts,Boom loders,25 ton cranes.recovery,pickup etc,for rent on long and short terms,Feel free to contact Mr,Nadeem Anjum for any hire information. Thanks RegardsMobile :- +971-568541425       :- +971-524188285Email :- we4dubai@gmail.com
Supplier : Mobile cranes for rent-052-4188285 DUBAI
Posted On :2 years ago

Saudi Abrasives steel shots supplier dubai

Saudi Abrasives steel shots supplier dubaiSteel Shots are spherical in shape, which are produced by the atomization of molten steel, followed by a series of thermal and mechanical treatment in order to attain martensite microstructure. Steel shots are widely used as a media for descaling steel components prior to coating. In this application the media is used almost exclusively in centrifugal wheel airless blasting equipment. It is also used in the foundry casting industry to remove sand from castings after removal from the mould and also for shot peening operations on metal components which are exposed to severe stress in automobile and construction machinery industriesUSES:- Removes sand and other surface contamination from steel and iron casting, cast pipes, malleable fittings copper and aluminium alloy castings and other general foundry products.- Descalling of forged steel products and heat-treated products.- Shot peening for automotive parts, aircraft components, railway casting, all sorts of gears, super hard steel chips, various tools.- Used in airless wheel blast machines to clean foundry castings, surface polishing and shot peening.- Also used in portable trackblast airless wheel blast machines for concrete floor preparation and profiling.- Long lasting and can be recycled around 100 times, making it the most economical and efficient abrasive.Steel shot is a non polluting blast media used extensively in the blast cleaning industry to remove paint, rust, millscale and other surface contaminants from steel, concrete and other surfaces prior to coating. It is also used to remove surface contaminations from casting parts in foundry. The cost effectiveness is incomparable due to its impact resistance qualities, durability and with utmost cleaning capacity.FEATURES:Particle Shape: Rounded abrasive particles produce a peened surface, whereas angular or irregular shaped abrasive particles produced an etched or angular surface profile. Selecting the right particle shape to produce the required profile and texture for the job at hand can impact productivity and performance of the coating applied.Particle Weight : Different metallic abrasives have different mass weights per unit volume and different impact values. For a given impact velocity and particle shape, the weight (mass) of the particle determines the shape and the depth of the profile produced.As steel abrasives have approximately 1-1/2 to 2-1/2 times the density of nonmetallic abrasive, steel abrasives create more impact for a given particle size. Smaller steel abrasive particles will produce the same impact value as nonmetallic particles 1-1/2 to 2 1/2 times larger. With the smaller steel abrasive there are more abrasive particles impacting the surface per unit time, which means faster cleaning rates. Particle Size : Abrasive particle size influences two primary functions of blast cleaning, rate of cleaning and profile. Decreasing particle size may increase cleaning rate because more particles are impacting the surface per unit time. Increasing abrasive size may be necessary to increase profile and/ or to remove heavy coatings.Particle Hardness : It is generally believed that the harder an abrasive, the better it will perform on difficult to clean areas.Dust Generation: Metallic abrasives do not break down on impact like conventional nonmetallic abrasive product's. Consequently, there is considerably less dust and waste generated during the blasting process. Low dust levels mean better visibility, faster cleaning, increased productivity and shorter cleanups, saving time and labor and disposal costs
Supplier : Abradant International LLC DUBAI
Posted On :2 years ago

ALLOY STEEL BUTT WELD FITTING P11

We are Manufacturer for ALLOY STEEL P11 grade Butt weld Fitting: -   Size:  -1/2” to 24” Schedules: -Sch 5, Sch 10, Sch 20, Sch 30, Sch 40, Sch STD, Sch 80, Sch XS, Sch 60, Sch 100, Sch 120, Sch 140, Sch 160, Sch XXS. Type: - SEAMLESS, WELDED. Description: -90Deg Elbow, 45Deg Elbow, Concentric Reducer, Eccentric Reducer, Cap, Tee, Reducing Tee, Unequal Tee.   Other standards:  - Alloy Steel chrome moly type 1.1/4Cr-1/2Mo ASTM /ASME A234 WP11 Din Standard  13CRM044 UNS K11572  Casting A217-WC6 Din W.No 1.7335   We also supply Flanges, Forged Fitting, Round bar, Outlets, Plate and Pipe.
Supplier : Gautam Steel Private Limited MUMBAI
Posted On :2 years ago

TEFLON TAPE SUPPLIERS IN UAE

TEFLON TAPE SUPPLIERS IN UAE
Supplier : Al Saqr Industries LLC SHARJAH
Posted On :2 years ago

STAINLESS STEEL NUTS & BOLTS

ALL SIZE AND GRADES ARE AVAILABLE.WE ALSO MAKE ON YOUR DEMAND .
Supplier : KRISHI ENGINEERING WORKS MUMBAI
Posted On :2 years ago

Modular Crimping Tool suppliers in Dubai

Infilink-Modular Crimping Tool for 8P8C/6P6C/6P4C
Supplier : Synergix International LLC DUBAI
Posted On :2 years ago

Huba 50/15 TOWER CRANE IN UAE

Huba 50/15 TOWER CRANE IN UAE
Supplier : HOUSE OF EQUIPMENT DUBAI
Posted On :2 years ago

Window Cleaning Equipment Suppliers In UAE

Daitona General Trading L.L.C. is one of the UAE’s leading general cleaning items and janitorial equipment supply companies. Ahmadaly Fazal, Managing Director and CEO, traces the company’s journey over the years. For any specialized professional organization, quality, training, service and competitiveness are a sure recipe for success - more so in an economy like Dubai. Daitona General Trading L.L.C. was set up in Dubai by Ahmadaly Fazal, the Managing Director and CEO, just before the Gulf War in 1991. He was following in the footsteps of his father, Late Habib Fazal who had sold his 2-year old cleaning items business in 1984 to migrate to Canada. In 2010, Ahmadaly Fazal was joined by his uncle and now Partner, Nizar Karmali, who is well-known in the institutional business. Today, Daitona General Trading L.L.C. employs 20 people who regularly undergo training in different subjects to keep them abreast with the industry. With his training background in a leading international organization, Karmali spends some of his time preparing course materials for training the Daitona team. Stocks, logistics and showroom: With all orders being required by ‘yesterday’, having ample stocks is crucial for offering prompt deliveries. Daitona carries a large inventory in its four warehouses in Sharjah and one in Dubai. More vehicles have been added to cope with the business growth and demands of the customers. With three pickup trucks and one van, the company smoothly handles all deliveries within UAE. Daitona took its first warehouse in Al Khabaisi area, Deira. The office was also within the warehouse. A year later, a display area was dedicated within the warehouse office. With the growth of the company in 2004 to 2006, Daitona acquired a full-fledged showroom cum office in Abu Hail, Deira. This was the first of its kind in the UAE, then. Today, Daitona is a one stop shop for all the cleaning and janitorial needs of its customers.   The future: The aim of Daitona General Trading L.L.C. is to continue being a leading supplier of quality and durable cleaning and janitorial equipment and accessories with focus on customer service. From a company starting off with air fresheners to one that sells all possible quality cleaning products (with the exception of heavy machines), Daitona General Trading L.L.C. has certainly come a long way.   The brands Daitona represent are: Hygiene System, Vita, IPC Ready System Italy, IPC Pulex Italy, Mr. Brush, KSI, Coronet, Aricasa, Celtex, Papernet, AZ Hygiene, Scentpur, Nu Fresh, Fragmatic, HS Chemicals, Cavallo, Baiyun Cleaning, etc... Under the above-mentioned brands we have the following products… Household Cleaning Products, House Keeping Cleaning Products, Cleaning equipment, Hotel Supplies, Hygiene Systems Cleaning Products, Daitona Cleaning Products, IPC Cleaning Products, Pulex Cleaning Products, Vita Cleaning Products, Mr. Brush Cleaning Products, Celtex Tissue Paper Products, Papernet Tissue Paper Products, Coronet Cleaning Products, Kach Sheng Cleaning Products, Baiyun Cleaning Products, Cavallo Cleaning Products, AZ Hygiene Product, Cleaning Equipment, Aricasa Cleaning Products, Scentpur Products, General Cleaning Products, Floor Cleaning Products, Window Cleaning Products, Janitorial equipment, Wash Room Cleaning Products, Kitchen Cleaning Products, Medical Rolls, Hand Towel Rolls, Center Feed Rolls, Maxi Rolls, Toilet Tissue Rolls, Jumbo Rolls, Toilet Rolls, C-fold Paper, V-Fold Paper, Z-Fold Paper, Interfold, Toilet Tissue Paper, Soft Brooms and Brushes, Hard Brooms and Brushes, Street Brooms,Coco Brooms, Dustpan Sets and Brushes, Vita Mops And Wipers, Floor Squeegees, Window Squeegees, Window Applicators, Aluminum handles, Mop Handles, Metal Handles, Mop Clips, Kentucky Mops, Dustpan and Brooms, Dust Bins, Steel Bins, Plastics Bins, Sanibins, Dry Mops, Wet Mops, Round Mops, Metal Clip Mops, Plastics Clip Mop, Door Mats, Urinal Blocks, Channel Blocks, Hand Soap Liquid, Antibacterial Hand Soap Liquid, Antiseptic Liquid, Foam Soap, All Purpose Cleaner, Pine Disinfectant, Antiseptic Disinfectant, Bleach Liquid, Glass Cleaning Liquid, Dishwashing Liquid, Rubber Gloves, Automatic Hand Dryers, Microfiber Mops, Microfiber Cloths, Housekeeping Trolleys, Janitorial Trolleys, Single Mop Buckets Trolleys, Double Mop Buckets, Mop Wringers, Litter Picker, Kitchen Towels, Paper Dispensers, Multi Fold Dispensers, Soap Dispensers, Aerosol Fragrance Dispensers, Aerosol Fragrance, Stainless Steel Bins, Plastic Garbage Bins, Waste Bins, HS Chemicals Products, Wet Floor Sign Board, Floor Scrubbing Pads, Automatic Aerosol Dispensers, Auto Soap Dispensers, Auto Foam Dispensers, Hand Sanitizer Dispensers, JRT Dispensers, Sponge Combo, Steel Wool, Scrubbing Pad, PP Duster, etc..... Tel-04-297-7972 & 04-268-3390 Email-info@daitona.com www.daitona.com
Supplier : DAITONA GENERAL TRADING (LLC) DUBAI
Posted On :2 years ago

DUCT INSULATION IN UAE

White Metal Contracting llc has always endeavoured to innovative and supports its clients to perform better, by meeting their demand for quality, service, competitiveness and timely completion of specified scope of work. Continuously achieve and improve the effectiveness of the works and systematic developments in the organization.White Metal Contracting llc is considered as one of the few specialist companies for supply and installation of industrial works, with proven experience in the UAE Construction projects.Email : sales@whitemetalco.comPlease visit our site : www.whitemetalco.com
Supplier : White Metal Contracting LLC AJMAN
Posted On :2 years ago

CHICKEN GRILL MACHINE شواية دجاج ماكينة

We Are Dealing All Type Of  Kitchen And Restaurant Equipments Spare Parts.Chicken Grill Machine and Spare Parts. for Inquiry Send Us Email On Sales@viaemex.com Or Contact Us.Tel: 06-5444118 Mobile: 050-7876364 ...
Supplier : Viaemex SHARJAH
Posted On :2 years ago

DOUGH DIVIDER IN UAE

This line can be a single, double, triple and quartet output to satisfy any customer's need concerning both production capacity and size. It can produce a range between 500 up to 1200 loafs per hour with a diameter between 15 to 40cm.
Supplier : EAST GATE BAKERY EQUIPMENT FACTORY ABU DHABI
Posted On :2 years ago

Cotton Rugs

Cotton Rugs Available in UAECotton Rugs Available in DubaiCotton Rugs Supplier in UAECotton Rugs Supplier in Dubai
Supplier : MINCORP Trading LLC DUBAI
Posted On :2 years ago

FIRE HOSE REELS IN ABU DHABI

These cabinets are available in either single door or double doors. Ideally, a single door weatherproof surface mounted Fire Hose Reel Cabinet is best suited to fixed and swinging hose reels – with an easy three step, one man installation. A free standing external cabinet is designed to mount on legs where the hose reel is sited away from a wall or support structure.Flush/recessed mounting cabinets complete with architrave surround frame, are used primarily in cavity/brick walls where a cover is required. A simple door and surround cabinet can be fixed to an opening, where a hose reel is built into the building. 
Supplier : STARS FIRE & SAFETY EQUIPMENT EST ABU DHABI
Posted On :2 years ago

PRICE LABELLING MACHINE

LABELLING MACHINE SUPPLIERS UN UAE
Supplier : Yashtech Services FZC SHARJAH
Posted On :2 years ago

Corrugated Roofing Sheet Oman

Pre Painted Galvanized Corrugated & Profile Roof Sheet Supplier in UAE OmanGhosh Metal Industries – Metal roofing profile is also named steel roof sheet, raw material is pre-painted hot dipped galvanized steel sheet, used as popular structural metal roofing materials and pre-painted aluminium coil sheet.Thickness: 0.30 mm to 0.90 mmStandard Width after corrugation: 1000 mmLength: Subject to customer choiceWith RAL Color of any as customer choice like RAL 9002 – Off White, RAL 1001 Beige, RAL 5012 Light Blue, RAL 5010 Dark Blue, RAL 5002 EMMAR Blue, RAL 7046 Dark Grey, RAL 7036 Grey, RAL 7037 Grey, RAL 1014 light beige, RAL 1015 Ivory, RAL 9003 White, RAL 9010 Pure White, RAL 3002 RED, RAL 3020 RED, RAL 2004 Orange, RAL 7015 Grey, RAL 6038 Green, RAL 6029 Light Green, and more.Ghosh Metal offerings high grade trapezoidal cladding sheets, which are widely installed for their attractive designs and robustness in buildings.These are built using high grade metals, such as stainless steel, copper, aluminum, zinc, bronze and titanium. The sheets come with accurate dimensions and are easy to installProfile design we have following cover width: – 35/200 mm – 45/250 mm x 1000 mm – 45/150 mm x 900 mmThe Advantage of Metal and Aluminium Roof Sheet: (1) Easy installation (2) High strength (3) Low in costs (4) Durable (5) Nice appearanceBelow is the required accessorises for the roof profile and sandwich panel sheet for shed and ware-house, industrial roof as top ridge, bottom ridge, rain gutter, vally gutter, and flashing corner.GHOSH METAL – has new corrugation line in UAE for S Type / waves type corrugation (Galvanized Corrugated) sheet with 16 to 20 mm. Waves and pitch waves distance 75 to 76 mm with cover width after corrugation 780 mm 900 mm 1000 mm x Length we can cut subject to our customer choice.Thickness: 0.28 mm (Gauge32 to Gauge20) to 0.90 mmGalvanized Steel of Ghosh Meal Dubai Ajman United Arab Emirates factory. .fusion-button.button-1 .fusion-button-text, .fusion-button.button-1 i {color:#fcfcfc;}.fusion-button.button-1 {border-width:0px;border-color:#fcfcfc;}.fusion-button.button-1 .fusion-button-icon-divider{border-color:#fcfcfc;}.fusion-button.button-1:hover .fusion-button-text, .fusion-button.button-1:hover i,.fusion-button.button-1:focus .fusion-button-text, .fusion-button.button-1:focus i,.fusion-button.button-1:active .fusion-button-text, .fusion-button.button-1:active{color:#ffffff;}.fusion-button.button-1:hover, .fusion-button.button-1:focus, .fusion-button.button-1:active{border-width:0px;border-color:#ffffff;}.fusion-button.button-1:hover .fusion-button-icon-divider, .fusion-button.button-1:hover .fusion-button-icon-divider, .fusion-button.button-1:active .fusion-button-icon-divider{border-color:#ffffff;}.fusion-button.button-1{background: #138ccc;}.fusion-button.button-1:hover,.button-1:focus,.fusion-button.button-1:active{background: #1a80b6;}.fusion-button.button-1{width:auto;} ENQUIRE FILL THE FORM or .fusion-button.button-2 .fusion-button-text, .fusion-button.button-2 i {color:#fcfcfc;}.fusion-button.button-2 {border-width:0px;border-color:#fcfcfc;}.fusion-button.button-2 .fusion-button-icon-divider{border-color:#fcfcfc;}.fusion-button.button-2:hover .fusion-button-text, .fusion-button.button-2:hover i,.fusion-button.button-2:focus .fusion-button-text, .fusion-button.button-2:focus i,.fusion-button.button-2:active .fusion-button-text, .fusion-button.button-2:active{color:#ffffff;}.fusion-button.button-2:hover, .fusion-button.button-2:focus, .fusion-button.button-2:active{border-width:0px;border-color:#ffffff;}.fusion-button.button-2:hover .fusion-button-icon-divider, .fusion-button.button-2:hover .fusion-button-icon-divider, .fusion-button.button-2:active .fusion-button-icon-divider{border-color:#ffffff;}.fusion-button.button-2{background: #138ccc;}.fusion-button.button-2:hover,.button-2:focus,.fusion-button.button-2:active{background: #1a80b6;}.fusion-button.button-2{width:auto;} CALL US (works on mobile or calling device)For enquiry and sales, please email us on parimal@ghoshgroups.com or call +971 553 258 409If you are on smartphone, press the nos to call directly
Supplier : GHOSH METAL INDUSTRIES LLC AJMAN
Posted On :2 years ago

VIVOIL GEAR PUMPS IN DUBAI

Group 0 Displacements from 0.16 cm3/revolution to 2.28 cm3/revolution. Maximum pressures up to 280 bar.Group 1 Displacements from 0.91 cm3/revolution to 9.88 cm3/revolution. Maximum pressures up to 300 bar.Group 2 Displacements from 4.2 cm3/revolution to 39.6 cm3/revolution. Maximum pressures up to 300 bar.Group 3 Displacements from 14.89 cm3/revolution to 86.87 cm3/revolution. Maximum pressures up to 320 bar.
Supplier : AMCA HYDRAULICS DUBAI
Posted On :2 years ago

ELECTRO FUSIION COUPLER DEALERS IN SHARJAH

BUTTWELDING MACHINE DEALERS IN SHARJAHWe have electro fusion Couplers ranging from 20mm to 630mm
Supplier : FUSIONPAC TECHNOLOGIES MIDDLE EAST FZE SHARJAH
Posted On :2 years ago

Bend Pipes

A pipe bending machine is vital component for any pipe bending project, particularly those of a large scale. A pipe bending machine makes the job easier and is capable of completing multiple jobs in less time than when working by hand. A pipe bending machine can be either handheld or floor mounted. In either case, the pipe bending machine allows the user to hold the pipe at one end of the channel while the shape roller forces the pipe through and carries it around in a curve. A pipe bending machine can be purchased with a variety of pipe bending capabilities. Material: A234-WPB A234-WP12 A234-WP11 A234-WP5 A403-WP304 A403-WP304L A403-WP316. A403-WP316L A420-WPL6, Ceramic LinedSpecial alloys: cooper nickel, Ni-based, Cu-based, Co-based, Fe-basedSize: Outer Diameter (D): D<=1220mm / Wall Thickness (T): T<=120mmPressure: SCH5 to SCH160Manufacturing standard: ANSI, JIS, DIN, EN, API 5L, etc.Bending Radius(R): 3D, 4D, 5D, 6D, 7D, 8D, 9D, 10DBending Angle: Degree 15, 30, 45, 60, 90, 135, 180 and also could manufacture according the angles given by the clients.Straight Length (L): The length between two ends general from 300mm-1500mm, and also can product according to the clients' requiry.End Bevel: According to the bevel of welding pipe fittings constructionPacking: Plywood Case/ Pallet/ other
Supplier : RAJRATAN STEEL CENTRE MUMBAI
Posted On :2 years ago

Anatomical Model of Heart (Dubai UAE)

This life size, two-part model comes complete with a stand. The parts separate to show internal structures of the ventricle and atrium, including valves. The roots of the vessels can also be seen.Dimensions: 12 x 12 x 22cm.
Supplier : Arasca Medical Equipment Trading LLC DUBAI
Posted On :2 years ago

WARNING TAPES EUROTAPE

AVAILABLE IN RED & WHITE / YELLOW & BLACK SIZE: 70MM x 500 Mtr
Supplier : Uruguay Group of Companies ABU DHABI
Posted On :3 years ago

STANLEY TOOLS SUPPLIERS IN UAE

Measuring Tools Finishing Tools Striking & Struck Tools Layout Tools Fastening Tools Storage Cutting Tools Laser Tools & Stud Sensors Automotive Tools Clamps & Vises Flashlights Woodworking Paint Preparation American Heritage High Visibility HVAC Tools
Supplier : Royal City Electrical Appliances LLC ABU DHABI
Posted On :3 years ago

GI PLAIN SHEETS

GI PLAIN SHEET 4' X 8' X 0.40 MM GI PLAIN SHEET 4' X 8' X 0.56 MM GI PLAIN SHEET 4' X 8' X 0.70 MM GI PLAIN SHEET 4' X 8' X 0.90 MM GI PLAIN SHEET 4' X 8' X 1.20 MM GI PLAIN SHEET 4' X 8' X 1.50 MM GI PLAIN SHEET 4' X 8' X 2.00 MM GI PLAIN SHEET 4' X 8' X 2.50 MM GI PLAIN SHEET 4' X 8' X 3.00 MM GI PLAIN SHEET 4' X 8' X 4.00 MM
Supplier : ACCORD TRADING L.L.C DUBAI
Posted On :3 years ago

GREEN SUCTION HOSE

GREEN SUCTION HOSE
Supplier : BETTER CHOICE BUILDING MATERIAL TRD. LLC DUBAI
Posted On :3 years ago

ALLOY 20 EYE BOLT

We are manufacturers & exporters of eye bolt in grade UNS 31803, UNS 32750, UNS32760, INCONEL, MONEL,TITANIUM, HASTELLOY, 304, 304L. 316. 316L. 317L. 316LN, 310S, 321, 321H, 347, 347H, 904L, HIGH TENSILE etc.For more details you can contact us freely at jainexmetal@gmail.com
Supplier : Jainex Metal Industries MUMBAI
Posted On :3 years ago

Wagner SF23 Plus Concrete Injection & Epoxy Spray

The powerful diaphragm airless spray pumps are robust, yet lightweight construction site and workshop units. Equipped with the new QLS technology they can apply a wide range of materials from paints and emulsions up to high viscosity materials, depending on the airless spray unit.Airless spray function allows the opportunity to work in the following aspect with the following equipment and materials :Painting Equipment, coating equipment, airless spray, spray paint, paint application, epoxy application, Hi- built paint, Air assist spray, Air coating spray, air coating, steel coating, heavy coat, high viscosity paint, intumiscent paint, flame retardant, anti corrosion paint, bituminous coating, Thick paint, thick coating, spray pack, airless spray paint, spray paint, airless spray.Contact Us:http://bit.ly/1icCd6Q
Supplier : OTAL L.L.C DUBAI
Posted On :3 years ago

PACKING FOAM ROLLS

Polyethylene (PE) Foam is composed of millions upon millions of tiny air cells in a blanket. Virtually crushproof, lint free, non-abrasive and chemically inert, PE Foam is available in anti-static as well as in roll, bag, and sheet versions.PE Foam 1m X 150m X 2mm
Supplier : Idea Star Packing Materials Trading LLC. DUBAI
Posted On :4 years ago

Pneumatic seals in Abu Dhabi

Supplier : SMART INDUSTRIAL EQUIPMENT L.L.C ABU DHABI
Posted On :4 years ago

GERBER ROUTERS Sabre 404 & 408

Features & BenefitsSuperior lead-screw driveAccurate tolerances, minimal maintenance and no lubricationMulti-size platformsAccommodates individual sign shopsAluminum constructionLighter weight and more rigid than steelPaneling (long-sign mode)Rout seamless signs of unlimited length from a continuous sheetSuperior Z-axis depth controlAccurately rout to the table surface without cutting the tableCut to mask accuracyPrecisely rout to material mask for securing small shapesT-VAC slotted vacuum tableUse vacuum, clamps or both to hold down material to tablePatented material hold and chip removal system Maintains material flatness and collects debris to ensure a clean work surfaceOpen architecture Supports a variety of file formatsIntuitive user interface Short learning curve and user intuitiveExclusive Gerber routing, engraving, and ADA bits Superior edge quality with longer tool life and lower costs
Supplier : MASONLITE SIGN SUPPLIES & EQUIPMENT DUBAI
Posted On :4 years ago

ALUMINIUM ANODIZING - UAE

We have all color of anodizing
Supplier : Stars Aluminium and Glass Company LLC SHARJAH
Posted On :4 years ago

CUSTOMIZED CHILLER UNITS

WE ARE PROVIDING CUSTOMIZED CHILLER UNITS ACCORDING TO THE REQUIREMENT OF CUSTOMERS.WE ARE ALSO PROVIDING A COMPLETE WARRANTY FOR OUR CHILLER UNITS INCLUDING COMPRESSOR.
Supplier : SAHARA AIR CONDITIONING & REFRIGERATION L.L.C DUBAI
Posted On :4 years ago

under water tools in uae

Supplier : NuTec Overseas SHARJAH
Posted On :5 years ago

Allen Bolt

Supplier : Om Exports PUNE
Posted On :5 years ago

Forklift Industrial Sweeper attachment

Industrial Sweeper Attachment. Best materials and a robust and high-performance product design – for challenging cleaning work – versatile and effective. Benefits: Maximum sweeping power Heavy duty General industrial applications Fast & effective Indoors & outdoors Economical Tougher sweeping applications Safe & user friendly Easy swap bristle replacement system No moving parts – durable & robust Low maintenance – easy to clean
Supplier : CONSTROMECH FZCO DUBAI
Posted On :5 years ago

THRU DRIVE HYDRAULIC VANE PUMPS

Contact :  Mr. CECIL SAMUELTel No   :  00971 2 - 6737900 / 055-9659600Email  :  sales@acecentro.comThru-drive pumps save installation space and cost by eliminating double shaft extension electric motors or by reducing the number of motors and drive couplings. Furthermore thru-drive models provide valuable circuit design flexibility, such as having the vane pump coupled with other types of pumps, both fixed and variable displacement, on a single input drive.The ten vane pump is particularly suitable for applications subject to sudden peaks of pressure, while the twelve vane model is specifically designed to meet very low noise requirements.
Supplier : ACE CENTRO ENTERPRISES ABU DHABI
Posted On :5 years ago

Stainless and Duplex Steel Butt Weld Fittings

Range : 15 NB upto 1200 NB IN SCH 5S, 10S, 10, 20, 40S, 40, STD, 60, 80S, 80, XS, 100, 120, 140, 160 & XXS Form : Seamless & welded long radius & short radius elbow 90 deg, long radius elbow 45 DEG, long radius & short radius elbow 90 deg, long radius elbow 45 deg, long radius & short radius elbow 180 deg (Return Bend), reducing elbow, equal tee, unequal tee, crosses, concentric reducer, eccentric reducer, long stubend, short stubend, coller, pipe cap, long radius bends R = 3 D, 5 D, 6 D, 8 D, 10 D & 20 D in 15 deg, 30 deg, 60 deg & 90 deg and drawing based butt weld fittings (Customised).
Supplier : KALIKUND STEEL & ENGG. CO. MUMBAI
Posted On :5 years ago

Hammer Handle Dubai

hammer handleheavy dutyhigh qualitybest qualitydurablelong lastingimperialinchesmetricmm
Supplier : A One Tools Trading LLC DUBAI
Posted On :6 years ago

Barcode Label Printer

Barcode Label Printers Direct Thermal, Thermal Transfer, Portable, Industrial & More Suitable for light or industrial printing needs.  
Supplier : SIS TECH GENERAL TRADING LLC DUBAI
Posted On :6 years ago

GUNNY BAG JUTE

Stock Available for empty gunny bag jute. for special price contact 0097150-4566160.
Supplier : SAFELAND TRADING L.L.C DUBAI
Posted On :6 years ago

Waterjet Cutting 80 Mesh Garnet

VVQ water cutting garnet 80 mesh Water jet cutting 80 mesh garnet is widely used in all waterjet cutting machines. Because of the best processing methods, it provides highest purity garnet and highly accurate size grains. It ensures that there is no dust or ineffective fine grains to restrict free flow of garnet. It also ensures that there is no oversize grains to block focusing tubes. Because of the steady flow of garnet without blockage allows uninterrupted production without downtime resulting in optimum efficiency and least production cost. It also provides the perfect balance between cutting speed and edge quality with reduced wear and tear to the equipment and in particular, the cutting head and focusing tube. Applications include stainless steel cutting, carbon steel cutting, marble cutting & aluminium cutting. Industry standard: 80 mesh Focusing tube - .030- .040"                            .762- 1.02mm Orifice- .010- .014" Contact: e-mail sblast@emirates.net.ae
Supplier : SPEED BLAST TRADING LLC DUBAI
Posted On :6 years ago

FABRICATOR SUPPLY

We have other company AJGC LLC for labours supply.We have all workers ( WELDER, FABRICATOR, HELPER)
Supplier : Al RAWAYS TENTS & CAR PARKING SUNSHADES ABU DHABI
Posted On :6 years ago

Fabricators

(For more details Contact, Mr. Sudhesh KS �Marketing Manager 050 5523711 / +971 4 2452400)Email :sudhesh@reyamirental.comEmail :salesuae@reyamirental.com
Supplier : RTS Construction Equipment Rental DUBAI
Posted On :6 years ago

Handrails Guardrails Wire rope Railings Crash Barriers Barricades Contractors Suppliers Company in UAE, Africa, Oman, Iran, Algeria, Qatar, Bahrain, Nigeria, Kenya, Uganda

Visit us www.Champions123.comwww.Championsdubai.comAll types of MS, GI, SS RAILINGS Suppliers, GRILLS, BALUSTRADES, BOLLARDS, STANCHIONS Suppliers, PANELS, POSTS Manufacturers, COLUMNS, GRILLS, SCREENS, METAL WALLS, BOUNDARY WALL Fabricators/ Contractors, COMPOUND WALLS Suppliers in UAE, etc. Supply, Installation/ Erection all across UAE ( Dubai, Abu Dhabi, Sharjah, Ajman, Ras Al Khaimah, RAK, Umm Al Quain, UAQ, Fujairah, Al Ain, Sila, Ruwais, Habshan, Tawila, Palace, Hotels, Malls, Parks, Parkings, Schools, Hospitals, Projects etc.) BARRICADES / BARRIERS / DIVIDERS for Events, Traffic, Shows, Hotels, Schools etc. in UAE, DUBAI, ABU DHABI ISO 9001:2008 certified PLS. CALL:     00971 - 50 - 5475666 e-mail:     ChampionsDubai@Gmail.com www.Champions123.com
Supplier : CHAMPIONS ENERGY, FENCE FENCING SUPPLIERS UAE, www.Champions123.com SHARJAH
Posted On :6 years ago

Hydraulic Hoses and Fittings

Medium Pressure Hydraulic Hose 40-250 bar, EN853 1SN,Meets x Exceeds SAE J517-100R1AT. Single seal wire braid, Black colour, Synthetic rubber. High Pressure Hydraulic Hose 80-415 bar, EN 853‐2SN Meets x Exceeds SAEJ517 100 R2AT.Double high tensile steel wire braid, black colour, Synthetic rubber. Low Pressure Hydraulic Hose 30-110 bar, EN854/SAE‐100 R3. Double fiber braid, Black colour, Synthetic rubber. Medium Pressure Hydraulic Hose 25-210 bar, SAE J517-100 R5. One high tensile steel wirebraid, Black colour, Single braid rubber impregnated fiber. Very Low Pressure and Low impulse Hydraulic Hose 20-30 bar, SAE J517-100 R6/EN854.Single fiber braid, Black colour, Synthetic rubber. High Pressure Hydraulic Hose 115-450 bar, BCS 174 : 1992. Double high tensile steel wire braid, Black colour, Synthetic rubber. High Pressure Critical applications in areas of HEMMs & Hydraulic system Poly hose proprietary product , 2 Special high tensile steel braid, Black colour, Synthetic rubber. LPG Hose BS:4089 Type 1/ IS 9573. Smooth bore, Single high tensile steel wire braid, Black colour, Synthetic rubber. Super High Pressure Hydraulic Hose AND Hydrostatic transmission line 350 bar, SAE J 517-100 R13/EN 856. Four or Six high tensile steel wire spirals, Black colour, Synthetic rubber. Steel Air Hose High Pressure for Compressed Air service Poly hose proprietary product Smooth bore, Single steel wire braid, Black/Yellow colour, Synthetic rubber. Very High Pressure Hydraulic Hose 170-500 bar, EN 856‐4SP. Four high tensile steel wire spirals, Black colour, Synthetic rubber. Super High Pressure Hydraulic Hose 250-700 bar, EN 856‐4SH. Four high tensile steel wire spirals, Black colour, Synthetic rubber. High Pressure Steam Hose at constant pressure of 150 psi, IS 10655 TYPE 2/ BS 5342. EPDM rubber resistant high temperature steam, Single wire braid, Black colour. High Temperature Steam Hose constant pressure of 259 psi, IS10655 TYPE 3/BS 5342. EPDM rubber resistant high temperature steam, Double steel wire braid, Black colour. Medium Pressure Hydraulic Hose 70-210 bar, SAE 100 R7/DIN EN 855. Thermoplastic Elastomer, 1 braid of synthetic fiber, can be used for industrial gases, Black/other(on request) colour, Available Twin/Multi lines. High pressure Hydraulic Hose 140-350 bar, SAE 100 R8/EN 855. Thermoplastic Elastomer, 2 braids of synthetic fiber, Black/other(on request) colour, Available Twin/Multi lines. Sewer Cleaning Hose (special construction for optimum cut and wear resistance) Light weight, Thermoplastic Elastomer, 1-2 braids of synthetic fiber, Orange colour‐ polyurethane cover.
Supplier : RICH TRADING CO. (L.L.C.) DUBAI
Posted On :6 years ago

Gasket Manufacturers

We have been in the manufacturing, supplying and export of world class forgings, rolls, shafts and many other products. We provide a vast range of products with perfect sizes and designs. Having an abundant number of proficient and talented professionals and latest technology, we have been able to break all the records in manufacturing excellent quality steel products. The array of products manufactured by us encompasses of features like good quality, excellent performance and long life durability. All the features like �established name among the manufacturers�, and �experience in the field� are well possessed by us, which forms the basis of optimum quality of the products manufactured by us.
Supplier : STEEL MART MUMBAI
Posted On :7 years ago

Heavy Equipment

Backhoes Bulldozers Cable Plow Compactors Cranes Crawler Loaders Dozer - Crawler / Wheel Dumpers Excavator Forklifts Graders Heavy Bulldozers Heavy Dozers Heavy Pipelayer Heavy Tractor Lifts Heavy Loader Backhoe Loaders Motor Graders Off-Highway Truck Pavers Pipelayer Scrapers Skid Steer Skid Steer Loaders Skidders Track Tractors Trailers Trenchers Trucks Wheel Loader Wheel Tractors
Supplier : Silverline LLC ABU DHABI
Posted On :7 years ago